A practical reference on research chemical: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-02-26 and is reviewed periodically as new material appears.
Regulatory treatment varies by country. In the United States the peptide is not approved as a medicine, and products offered for human use may be treated as unapproved new drugs; some states also restrict sale. Australia, the United Kingdom, and European Union member states apply comparable restrictions to unapproved peptide products. Border agencies have seized shipments labelled as research chemicals. Classification may change over time, and the legal position for personal importation is not clearly settled in most published guidance.
Lyophilised melanotan-2 is supplied as a solid, which is more stable than a solution. The material is hygroscopic, so weighing is done quickly, in low humidity, with the container kept sealed. Reconstitution usually uses water for injection or bacteriostatic water, added down the wall of the vial to limit foaming. A reconstituted solution is held at 2 to 8 °C and kept away from light. Repeated freezing and thawing of the same vial is avoided because ice crystal formation and concentration effects degrade the peptide.
Melanocortin receptors comprise five subtypes with distinct tissue distributions and functions. Melanotan-2 is described in the literature as a non-selective agonist that engages several of these subtypes, including MC1R, MC3R, MC4R, and MC5R. MC1R is the subtype most directly linked to melanin production in skin cells. Because the compound is not subtype-selective, its observed effects in experimental settings are generally attributed to activity across multiple receptor pathways rather than to a single target.
Melanotan-2 is a synthetic linear peptide built from seven amino acids arranged in a short chain. Its sequence is commonly written as Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2, which includes a modified N-terminus and an amidated C-terminus. The molecule belongs to the melanocortin family and acts as a receptor agonist. Structural features such as the D-phenylalanine residue and the Nle substitution are associated with increased stability against enzymatic degradation relative to the natural parent peptide.
The compound emerged from research programs in the 1980s that examined analogues of alpha-melanocyte-stimulating hormone for pigmentation and photoprotection. Investigators modified the native sequence to extend activity duration and potency. A related analogue, afamelanotide, was developed within the same broad line of inquiry and eventually gained approval in certain jurisdictions for a rare light-sensitivity condition. Melanotan-2 itself did not progress through the same regulatory route and has no approved therapeutic indication.
| Property | Value | Notes |
|---|---|---|
| Lyophilised storage | −20 °C, dry, protected from light | Vials are sealed and allowed to reach room temperature before opening |
| Reconstituted storage | 2 to 8 °C, protected from light | Short-term holding; avoid repeated freeze-thaw cycles |
| Reconstitution solvent | Water for injection or bacteriostatic water | Added slowly along the vial wall to reduce foaming and shear |
| Purity measurement | RP-HPLC with area normalisation | Acetonitrile-water gradient monitored at roughly 214 nm |
| Identity confirmation | Electrospray ionisation mass spectrometry | Observed mass compared against the calculated peptide mass |
Regulatory status differs by country, and in many places supplying the compound for human consumption is unlawful. Vendors frequently label material as intended for research use only, a designation that shifts stated purpose but does not create a legal pathway for personal use. Certificates of analysis accompanying such products vary widely in detail and provenance. Third-party testing exists but is voluntary, and results are rarely linked to a specific lot in a publicly verifiable way.
Identity testing for a synthetic peptide relies on several complementary methods. Reversed-phase high-performance liquid chromatography separates the target from related impurities and reports purity as a percentage of total peak area. Mass spectrometry confirms molecular mass and can reveal deletions or truncations. Amino acid analysis and peptide mapping provide sequence-level confirmation, while counter-ion content and residual solvents are measured separately. A purity figure alone does not establish identity, so a complete dataset combines chromatographic and spectrometric evidence.
Lyophilized peptide powder is generally stored frozen, protected from light and moisture. Tryptophan residues are susceptible to oxidation, and the lactam bridge can hydrolyze under strongly acidic or basic conditions. Solutions prepared for laboratory work degrade faster than dry powder, and repeated freeze-thaw cycles accelerate loss. Common practice is to aliquot solutions before freezing and to avoid alkaline buffers. Reported stability windows vary with concentration, buffer, and temperature, so exact shelf lives are method-specific rather than universal.
The peptide was developed during the 1980s by researchers investigating melanocortin signalling and skin pigmentation pathways. Early work focused on analogues of alpha-melanocyte-stimulating hormone that would resist enzymatic breakdown more effectively than the parent molecule. Melanotan-2 emerged from that programme as a shortened, cyclised variant. Reports describing its synthesis and receptor activity later appeared in the scientific literature. Commercial availability grew through unregulated channels rather than through pharmaceutical approval.
Structurally, Melanotan-2 retains the core recognition motif of alpha-melanocyte-stimulating hormone while adding a lactam bridge that links two side chains and constrains the molecule into a ring. This modification lowers susceptibility to enzymatic degradation. The compound acts as an agonist at melanocortin receptors, particularly subtypes associated with melanin production. Because the same receptor family influences several physiological processes, researchers note that its activity is not confined to pigmentation alone. Receptor selectivity continues to be examined in published studies.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its sequence incorporates modified residues that increase potency and extend biological activity relative to the native hormone. The compound binds receptors of the melanocortin family and is examined mainly in laboratory research. It does not occur naturally and exists only as a manufactured chemical entity produced by solid-phase synthesis.
Melanotan-2 is handled in the laboratory as a lyophilised powder that dissolves readily in water, dimethyl sulfoxide and dimethylformamide, with limited solubility in ethanol. Stock solutions prepared in an organic solvent often precipitate when diluted into aqueous buffer, so gradual dilution with mixing is standard practice. The peptide carries a tryptophan residue and a histidine residue, both sensitive to oxidation and to alkaline conditions. Working solutions are therefore kept near neutral to slightly acidic pH, protected from light, and consumed within the same working session whenever that is practical.
Solid peptide kept dry at minus twenty degrees Celsius, shielded from light and moisture, is generally considered stable for extended periods. Solutions are divided into single-use aliquots and held at minus twenty or minus eighty degrees Celsius, because repeated freeze-thaw cycles promote aggregation and loss of material to container surfaces. Hydrolysis of the backbone and oxidation of tryptophan are the principal degradation routes in aqueous solution, and both accelerate at ambient temperature. Hygroscopic uptake after a vial is opened can also shift the actual mass weighed, which affects any concentration calculated from it.
== Diagnosis == A combination of physical examination of the arch and plantar fascia, as well as ultrasound imaging by a physician is the usual path to diagnosis. An MRI (Magnetic Resonance Imaging) scan is usually the imaging of choice to determine between other possible conditions such as ganglion cysts. MRI tends to be more accurate than x-ray or ultrasound, showing the full extent of the condition.
== Reception == Half Life received mixed-to-positive reviews; Newsweek called it "brilliant and funny," and The New York Times, while praising Jackson's ambition as "truly glorious," added that "All this razzle-dazzle, all the allusions, [and] the narrative loop-de-loops [get] a bit busy." It won the 2006 James Tiptree, Jr. Award for science fiction and fantasy.
Blocking LRP5 expression using siRNA against LRP5 resulted in a significant decrease in MMP13 mRNA and protein expressions. The catabolic role of LRP5 appears to be mediated by the Wnt/beta-catenin pathway in human osteoarthritis. The polyphenol curcumin increases the mRNA expression of LRP5.
== Treatment == For people with the FOLR1 mutation, even when the systemic deficiency is corrected by folate (the oxidized form - folic acid), the cerebral deficiency remains, and must be treated with folinic acid. Folinic acid is a metabolically active form of folate that can be easily introduced into the folate cycle. A typical dose that is administered to children is 0.5–1 mg/kg daily, but the dose can be increased depending on the severity of symptoms and the age of the child. Over time, the treatment with folinic acid has shown to reduce a variety of symptoms of CFD. The treatment of folinic acid can lead to improvements in walking, speech, interpersonal skills and reduction in seizures. Success depends on early initiation of treatment. Starting the folinic acid treatment before the age of six is more advantageous for the child with CFD. If the treatment is started after the age of six, its results are not as effective. Treatment requires taking folinic acid for lengthy periods. Fewer than 20 people with the FOLR1 defect have been described in the medical literature. Folinic acid (5-formyl-THF, 5-fTHF) also appears useful for some other forms of CFD. Pharmacologic doses of folinic acid has also led to reversal of some symptoms in children diagnosed with cerebral folate deficiency and testing positive for autoantibodies to folate receptor alpha. It also appears useful in DHFR deficiency and AADC deficiency. 5-MTHF (5-methyl-THF) is also available as a drug (levomefolic acid). It is "thought to be the most efficient way to restore CSF 5-MTHF concentrations".
A subarachnoid hemorrhage is acute bleeding under the arachnoid; it may occur spontaneously or as a result of trauma. A subdural hematoma (SDH) is an extracerebral collection of blood located in the potential space that can separate arachnoid from the dura mater. The origin is usually venous, caused by injury to the bridging veins that connect the dura mater and the arachnoid. Once these are torn, blood leaks into this area. SDHs occur in about 30% cases of severe head trauma. An epidural hematoma (EDH) is a collection of blood between the skull and the dura mater, underlying a bare bone surface. It is often associated with skull fracture. EDH may be arterial (caused by injury of a meningeal artery) or venous (related to damage to of a dural venous sinus or bleeding from diploic veins).
Sources: en.wikipedia.org
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Burkett (1984), award-winning correspondent for WABC-TV Matthew Cooper (1984), Time magazine White House correspondent and defendant in the Valerie Plame investigation Tom Watson (1984), journalist, entrepreneur Thomas Vinciguerra (1985), journalist, editor and author Naftali Bendavid (1986), Congress correspondent for The Wall Street Journal Susan Benesch (1986), journalist, free speech advocate Elizabeth Rubin (1987), journalist for The New York Times Magazine, sister of Bloomberg News executive editor James Rubin '82 Aram Roston (1988), investigative journalist Edward Lewine (1989), author and freelance journalist Sam Marchiano (1989), television sportscaster, documentarian and activist, daughter of sportscaster Sal Marchiano David Streitfeld (1989), book reporter for The Washington Post; winner of the 2013 Pulitzer Prize for Explanatory Reporting Caroline Glick (1991), Israeli journalist, editor, writer Warren St. John (1991), journalist for The New York Times and former CEO of Patch Michael J. Socolow (1991), broadcast journalist and professor at the University of Maine Jesse Eisinger (1992), Pulitzer Prize-winning reporter for ProPublica Jean H.
== References == 11. Website publication of Silver Book: The Silver Book and the NPU Format for Clinical Laboratory Science Reports Regarding Properties, Units, and Symbols . Published Online: 2017-04-25; Published in Print: 2017-04-25
==== Diarrhea ==== In cases of diarrhea-predominate irritable bowel syndrome, opioids may be used to suppress diarrhea. Loperamide is a peripherally selective opioid available without a prescription used to suppress diarrhea. The ability to suppress diarrhea also produces constipation when opioids are used beyond several weeks.
== Research == In 2024, deupsilocin received a breakthrough therapy designation from the U.S. FDA and was in phase 3 clinical trials for major depressive disorder and is in the preclinical stage of development for alcoholism and other psychiatric disorders. Two phase 3 clinical trials for major depressive disorder are being initiated in November 2024 and February 2025. The drug is under development by Helus Pharma (formerly Cybin).
Sources: en.wikipedia.org
Low temperature slows hydrolysis and oxidation, the two main routes by which the peptide backbone and side chains are modified. A lyophilised powder stored at −20 °C is more stable than one kept at room temperature, and once the material is dissolved the degradation rate rises, making refrigeration more important.
Liquid chromatography coupled to mass spectrometry is the most common approach because it combines a retention time with a mass measurement. A chromatographic peak alone cannot establish which peptide is present, so mass determination or amino acid analysis is used as an orthogonal confirmation alongside the separation.
This depends on buffer, pH, and concentration, and published stability data for this peptide are limited. In practice laboratories work through a refrigerated solution within a few weeks and discard samples that show cloudiness or visible particles. Freezing and thawing repeatedly is generally discouraged.
No. Melanotan-2 is manufactured synthetically. The naturally occurring peptide in the same family is alpha-melanocyte-stimulating hormone, which the body produces as part of normal endocrine and neural signalling.